PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050799.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 307aa    MW: 34836.2 Da    PI: 8.1112
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050799.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.97.9e-3186140358
   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                   ++rY+eClkNhA+s+Ggh+vDGCgEfmp  g+egt++ ++CaAC CHRnFHR+e +
  EcC050799.10  86 NFRYRECLKNHAISIGGHVVDGCGEFMPR-GDEGTPEFFRCAACSCHRNFHRKEIV 140
                   789*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-1982138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.3E-2987139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.9E-2888139IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.90789138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466897.9E-18236303IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-27236304IPR009057Homeodomain-like
TIGRFAMsTIGR015654.7E-28242299IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
PNMEPRSEED QARIPNSLLY DHPNPPNGER KIDHGQNHVI STQTLDQPKP RIDDLLQPSV  60
PTSSPPSAEF PNMMALTQAL PPPPANFRYR ECLKNHAISI GGHVVDGCGE FMPRGDEGTP  120
EFFRCAACSC HRNFHRKEIV AHGGGELGYM ANFQYNHRNG NILSYGQIRH AANSIPHQQT  180
LLHQSRHSQS FSPGPAQPVM VAFGGGGEAE SSSEDLGAFQ RGDGGRWRHE ELLAVQMQQS  240
PKKRFRTKFS EEQKERMMEF AEKLGWKMQK GDEDEVVKFC EEVRVKRQVF KVWMHNNKQT  300
MKRKQPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-202433001875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010026173.10.0PREDICTED: zinc-finger homeodomain protein 6-like
TrEMBLA0A0L9TP108e-76A0A0L9TP10_PHAAN; Uncharacterized protein
STRINGPOPTR_0005s12420.16e-73(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.14e-55homeobox protein 24